CTHRC1 (NM_138455) Human Mass Spec Standard

CAT#: PH304348

CTHRC1 MS Standard C13 and N15-labeled recombinant protein (NP_612464)

Product Images

Coomassie blue staining of purified CTHRC1 protein (Cat# TP304348). The protein was produced from HEK293T cells transfected with CTHRC1 cDNA clone (Cat# RC204348) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204348
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204348 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPG
  ANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVL
  FSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVD
  VAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612464
• RefSeq Size: 1279
• RefSeq ORF: 729
• Synonyms: collagen triple helix repeat containing 1
• Locus ID: 115908
• UniProt ID: Q96CG8
• Cytogenetics: 8q22.3
• Summary: This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]
• Protein Families: Secreted Protein