CDC37L1 (NM_017913) Human Mass Spec Standard

CAT#: PH304355

CDC37L1 MS Standard C13 and N15-labeled recombinant protein (NP_060383)

Product Images

Coomassie blue staining of purified CDC37L1 protein (Cat# TP304355). The protein was produced from HEK293T cells transfected with CDC37L1 cDNA clone (Cat# RC204355) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204355
• Predicted MW: 38.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204355 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQPWPPPGPWSLPRAEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSVACKWN
  LAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSF
  INQDKRKDTEDEDKSESFMQKYEQKIRHFGMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKG
  ALMEQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQ
  PMTVQNHVPHSGVGSIGLLESLPQNPDYLQYSISTALCSLNSVVHKEDDEPKMMDTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060383
• RefSeq Size: 1724
• RefSeq ORF: 1011
• Synonyms: CDC37B; HARC
• Locus ID: 55664
• UniProt ID: Q7L3B6
• Cytogenetics: 9p24.1
• Summary: CDC37L1 is a cytoplasmic phosphoprotein that exists in complex with HSP90 (HSPCA; MIM 140571) as well as several other proteins involved in HSP90-mediated protein folding (Scholz et al., 2001 [PubMed 11413142]). [supplied by OMIM, Mar 2008]