CDC37L1 (NM_017913) Human Recombinant Protein
CAT#: TP304355
Recombinant protein of human cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1)
View other "CDC37L1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204355 protein sequence
Red=Cloning site Green=Tags(s) MEQPWPPPGPWSLPRAEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSVACKWN LAEAQQKLGSLALHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSF INQDKRKDTEDEDKSESFMQKYEQKIRHFGMLSRWDDSQRFLSDHPYLVCEETAKYLILWCFHLEAEKKG ALMEQIAHQAVVMQFIMEMAKNCNVDPRGCFRLFFQKAKAEEEGYFEAFKNELEAFKSRVRLYSQSQSFQ PMTVQNHVPHSGVGSIGLLESLPQNPDYLQYSISTALCSLNSVVHKEDDEPKMMDTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060383 |
Locus ID | 55664 |
UniProt ID | Q7L3B6 |
Cytogenetics | 9p24.1 |
Refseq Size | 1724 |
Refseq ORF | 1011 |
Synonyms | CDC37B; HARC |
Summary | CDC37L1 is a cytoplasmic phosphoprotein that exists in complex with HSP90 (HSPCA; MIM 140571) as well as several other proteins involved in HSP90-mediated protein folding (Scholz et al., 2001 [PubMed 11413142]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402629 | CDC37L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402629 | Transient overexpression lysate of cell division cycle 37 homolog (S. cerevisiae)-like 1 (CDC37L1) |
USD 396.00 |
|
PH304355 | CDC37L1 MS Standard C13 and N15-labeled recombinant protein (NP_060383) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review