NUDT18 (NM_024815) Human Mass Spec Standard

CAT#: PH304376

NUDT18 MS Standard C13 and N15-labeled recombinant protein (NP_079091)

Product Images

Coomassie blue staining of purified NUDT18 protein (Cat# TP304376). The protein was produced from HEK293T cells transfected with NUDT18 cDNA clone (Cat# RC204376) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204376
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204376 representing NM_024815
  Red=Cloning site Green=Tags(s)
  
  MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGS
  WYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESL
  QAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVG
  MPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRS
  PGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079091
• RefSeq Size: 1519
• RefSeq ORF: 969
• Synonyms: MTH3
• Locus ID: 79873
• UniProt ID: Q6ZVK8
• Cytogenetics: 8p21.3
• Summary: The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This protein contains a Nudix hydrolase domain and hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates. [provided by RefSeq, Sep 2012]