GJB4 (NM_153212) Human Mass Spec Standard

CAT#: PH304406

GJB4 MS Standard C13 and N15-labeled recombinant protein (NP_694944)

Product Images

Coomassie blue staining of purified GJB4 protein (Cat# TP304406). The protein was produced from HEK293T cells transfected with GJB4 cDNA clone (Cat# RC204406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204406
• Predicted MW: 30.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFP
  VSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAA
  VDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVG
  KRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_694944
• RefSeq Size: 2840
• RefSeq ORF: 798
• Synonyms: CX30.3; EKV; EKVP2
• Locus ID: 127534
• UniProt ID: Q9NTQ9
• Cytogenetics: 1p34.3
• Summary: This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]
• Protein Families: Ion Channels: Other, Transmembrane