beta TRCP2 (FBXW11) (NM_033644) Human Mass Spec Standard
CAT#: PH304407
FBXW11 MS Standard C13 and N15-labeled recombinant protein (NP_387448)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204407 |
Predicted MW | 60.9 kDa |
Protein Sequence |
>RC204407 protein sequence
Red=Cloning site Green=Tags(s) MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQW SESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKE WQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNW RCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVI VTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHR AAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG ACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEF QIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_387448 |
RefSeq Size | 4536 |
RefSeq ORF | 1587 |
Synonyms | BTRC2; BTRCP2; FBW1B; Fbw11; FBXW1B; Hos |
Locus ID | 23291 |
UniProt ID | Q9UKB1 |
Cytogenetics | 5q35.1 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Hedgehog signaling pathway, Oocyte meiosis, Ubiquitin mediated proteolysis, Wnt signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409480 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409481 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC415862 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC429361 | FBXW11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409480 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 2 |
USD 396.00 |
|
LY409481 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 1 |
USD 605.00 |
|
LY415862 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 3 |
USD 605.00 |
|
LY429361 | Transient overexpression lysate of F-box and WD repeat domain containing 11 (FBXW11), transcript variant 3 |
USD 396.00 |
|
TP304407 | Recombinant protein of human F-box and WD repeat domain containing 11 (FBXW11), transcript variant 2 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review