BLBP (FABP7) (NM_001446) Human Mass Spec Standard

CAT#: PH304449

FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437)

Product Images

Coomassie blue staining of purified FABP7 protein (Cat# TP304449). The protein was produced from HEK293T cells transfected with FABP7 cDNA clone (Cat# RC204449) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204449
• Predicted MW: 14.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204449 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE
  FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001437
• RefSeq Size: 1005
• RefSeq ORF: 396
• Synonyms: B-FABP; BLBP; FABPB; MRG
• Locus ID: 2173
• UniProt ID: O15540
• Cytogenetics: 6q22.31
• Summary: 'The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016]'
• Protein Pathways: PPAR signaling pathway