BLBP (FABP7) (NM_001446) Human Recombinant Protein
CAT#: TP304449
Recombinant protein of human fatty acid binding protein 7, brain (FABP7)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204449 protein sequence
Red=Cloning site Green=Tags(s) MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE FDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001437 |
Locus ID | 2173 |
UniProt ID | O15540 |
Cytogenetics | 6q22.31 |
Refseq Size | 1005 |
Refseq ORF | 396 |
Synonyms | B-FABP; BLBP; FABPB; MRG |
Summary | The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419933 | FABP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419933 | Transient overexpression lysate of fatty acid binding protein 7, brain (FABP7) |
USD 396.00 |
|
PH304449 | FABP7 MS Standard C13 and N15-labeled recombinant protein (NP_001437) |
USD 2,055.00 |
|
TP720119 | Recombinant protein of human fatty acid binding protein 7, brain (FABP7) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review