SEC62 (NM_003262) Human Mass Spec Standard

CAT#: PH304452

SEC62 MS Standard C13 and N15-labeled recombinant protein (NP_003253)

Product Images

Coomassie blue staining of purified SEC62 protein (Cat# TP304452). The protein was produced from HEK293T cells transfected with SEC62 cDNA clone (Cat# RC204452) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204452
• Predicted MW: 45.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204452 representing NM_003262
  Red=Cloning site Green=Tags(s)
  
  MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEA
  LFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKE
  KKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAA
  TLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRP
  LYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRRED
  DRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003253
• RefSeq Size: 6541
• RefSeq ORF: 1197
• Synonyms: Dtrp1; HTP1; TLOC1; TP-1
• Locus ID: 7095
• UniProt ID: Q99442
• Cytogenetics: 3q26.2
• Summary: 'The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane