Claudin 1 (CLDN1) (NM_021101) Human Mass Spec Standard

CAT#: PH304466

CLDN1 MS Standard C13 and N15-labeled recombinant protein (NP_066924)

Product Images

Coomassie blue staining of purified CLDN1 protein (Cat# TP304466). The protein was produced from HEK293T cells transfected with CLDN1 cDNA clone (Cat# RC204466) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204466
• Predicted MW: 22.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204466 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSL
  LNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWY
  GNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDY
  V
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066924
• RefSeq Size: 3452
• RefSeq ORF: 633
• Synonyms: CLD1; ILVASC; SEMP1
• Locus ID: 9076
• UniProt ID: O95832, A5JSJ9
• Cytogenetics: 3q28
• Summary: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Tight junction