SLC1A4 (NM_003038) Human Mass Spec Standard

CAT#: PH304487

SLC1A4 MS Standard C13 and N15-labeled recombinant protein (NP_003029)

Product Images

Coomassie blue staining of purified SLC1A4 protein (Cat# TP304487). The protein was produced from HEK293T cells transfected with SLC1A4 cDNA clone (Cat# RC204487) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204487
• Predicted MW: 55.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204487 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGAALRGLSLSRT
  QVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAYFGLTTLSASALAVALAFIIK
  PGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHE
  KIPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSK
  IVEMKDIIVLVTSLGKYIFASILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLP
  SMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGA
  AGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELA
  EVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003029
• RefSeq Size: 4611
• RefSeq ORF: 1596
• Synonyms: ASCT1; SATT; SPATCCM
• Locus ID: 6509
• UniProt ID: P43007
• Cytogenetics: 2p14
• Summary: 'The protein encoded by this gene is a sodium-dependent neutral amino acid transporter for alanine, serine, cysteine, and threonine. Defects in this gene have been associated with developmental delay, microcephaly, and intellectual disability. [provided by RefSeq, Jan 2017]'
• Protein Families: Druggable Genome, Transmembrane