BCL2 (NM_000633) Human Mass Spec Standard

CAT#: PH304498

BCL2 MS Standard C13 and N15-labeled recombinant protein (NP_000624)

Product Images

Coomassie blue staining of purified BCL2 protein (Cat# TP304498). The protein was produced from HEK293T cells transfected with BCL2 cDNA clone (Cat# RC204498) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204498
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC204498 representing NM_000633
  Red=Cloning site Green=Tags(s)
  
  MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS
  PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD
  GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF
  DFSWLSLKTLLSLALVGACITLGAYLGHK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000624
• RefSeq Size: 6492
• RefSeq ORF: 717
• Synonyms: Bcl-2; PPP1R50
• Locus ID: 596
• UniProt ID: P10415, A0A024R2B3
• Cytogenetics: 18q21.33
• Summary: 'This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane
• Protein Pathways: Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Focal adhesion, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer