ZMYND19 (NM_138462) Human Mass Spec Standard

CAT#: PH304509

ZMYND19 MS Standard C13 and N15-labeled recombinant protein (NP_612471)

Product Images

Coomassie blue staining of purified ZMYND19 protein (Cat# TP304509). The protein was produced from HEK293T cells transfected with ZMYND19 cDNA clone (Cat# RC204509) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204509
• Predicted MW: 26.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204509 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHE
  LLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQ
  FPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKK
  HCRERKRPFQHELEPER
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612471
• RefSeq Size: 1371
• RefSeq ORF: 681
• Synonyms: MIZIP
• Locus ID: 116225
• UniProt ID: Q96E35
• Cytogenetics: 9q34.3
• Summary: ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1 (MCHR1; MIM 601751) (Bachner et al., 2002 [PubMed 12208518]), and to the N termini of alpha-tubulin (TUBA1; MIM 191110), and beta-tubulin (TUBB; MIM 191130) (Francke et al., 2005 [PubMed 16039987]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome