CENPH (NM_022909) Human Mass Spec Standard

CAT#: PH304531

CENPH MS Standard C13 and N15-labeled recombinant protein (NP_075060)

Product Images

Coomassie blue staining of purified CENPH protein (Cat# TP304531). The protein was produced from HEK293T cells transfected with CENPH cDNA clone (Cat# RC204531) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204531
• Predicted MW: 28.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204531 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE
  QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI
  MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT
  VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075060
• RefSeq Size: 1405
• RefSeq ORF: 741
• Synonyms: centromere protein H; kinetochore protein CENP-H; NNF1; NNF1, MIND kinetochore complex component, homolog; PMF1
• Locus ID: 64946
• UniProt ID: Q9H3R5, A0A0S2Z5T0
• Cytogenetics: 5q13.2
• Summary: Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome