GFAP (NM_002055) Human Mass Spec Standard

CAT#: PH304548

GFAP MS Standard C13 and N15-labeled recombinant protein (NP_002046)

Product Images

Coomassie blue staining of purified GFAP protein (Cat# TP304548). The protein was produced from HEK293T cells transfected with GFAP cDNA clone (Cat# RC204548) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204548
• Predicted MW: 49.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204548 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER
  AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE
  RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE
  LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH
  EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ
  DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
  IKESKQEHKDVM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002046
• RefSeq Size: 3097
• RefSeq ORF: 1296
• Synonyms: ALXDRD
• Locus ID: 2670
• UniProt ID: P14136
• Cytogenetics: 17q21.31
• Summary: 'This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]'
• Protein Families: ES Cell Differentiation/IPS