GFAP (NM_002055) Human Mass Spec Standard
CAT#: PH304548
GFAP MS Standard C13 and N15-labeled recombinant protein (NP_002046)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204548 |
Predicted MW | 49.9 kDa |
Protein Sequence |
>RC204548 protein sequence
Red=Cloning site Green=Tags(s) MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002046 |
RefSeq Size | 3097 |
RefSeq ORF | 1296 |
Synonyms | ALXDRD |
Locus ID | 2670 |
UniProt ID | P14136 |
Cytogenetics | 17q21.31 |
Summary | 'This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]' |
Protein Families | ES Cell Differentiation/IPS |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419563 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427360 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419563 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 1 |
USD 325.00 |
|
LY427360 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 2 |
USD 325.00 |
|
TP304548 | Recombinant protein of human glial fibrillary acidic protein (GFAP), transcript variant 1 |
USD 823.00 |
|
TP720201 | Purified recombinant protein of Homo sapiens glial fibrillary acidic protein (GFAP), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review