CAB39 (NM_016289) Human Mass Spec Standard
CAT#: PH304563
CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_057373)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204563 |
Predicted MW | 39.9 kDa |
Protein Sequence |
>RC204563 protein sequence
Red=Cloning site Green=Tags(s) MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057373 |
RefSeq Size | 3846 |
RefSeq ORF | 1023 |
Synonyms | CGI-66; MO25 |
Locus ID | 51719 |
UniProt ID | Q9Y376, A0A024R496 |
Cytogenetics | 2q37.1 |
Protein Pathways | mTOR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402536 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427286 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427287 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402536 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 1 |
USD 325.00 |
|
LY427286 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 2 |
USD 325.00 |
|
LY427287 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 3 |
USD 325.00 |
|
PH325504 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321) |
USD 2,055.00 |
|
PH325505 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124322) |
USD 2,055.00 |
|
TP304563 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 1 |
USD 823.00 |
|
TP325504 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 2 |
USD 748.00 |
|
TP325505 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review