TFIIB (GTF2B) (NM_001514) Human Mass Spec Standard

CAT#: PH304607

GTF2B MS Standard C13 and N15-labeled recombinant protein (NP_001505)

Product Images

Coomassie blue staining of purified GTF2B protein (Cat# TP304607). The protein was produced from HEK293T cells transfected with GTF2B cDNA clone (Cat# RC204607) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204607
• Predicted MW: 34.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204607 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDS
  QNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNN
  LFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLIT
  TGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGV
  ADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001505
• RefSeq Size: 1651
• RefSeq ORF: 948
• Synonyms: TF2B; TFIIB
• Locus ID: 2959
• UniProt ID: Q00403
• Cytogenetics: 1p22.2
• Summary: 'This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors