SERPINA10 (NM_016186) Human Mass Spec Standard

CAT#: PH304642

SERPINA10 MS Standard C13 and N15-labeled recombinant protein (NP_057270)

Product Images

Coomassie blue staining of purified SERPINA10 protein (Cat# TP304642). The protein was produced from HEK293T cells transfected with SERPINA10 cDNA clone (Cat# RC204642) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204642
• Predicted MW: 50.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204642 representing NM_016186
  Red=Cloning site Green=Tags(s)
  
  MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMA
  SRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGL
  LPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYIN
  KETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFD
  KNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHE
  LLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPF
  HFMIYEETSGMLLFLGRVVNPTLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057270
• RefSeq Size: 2466
• RefSeq ORF: 1332
• Synonyms: PZI; ZPI
• Locus ID: 51156
• UniProt ID: Q9UK55, A0A024R6I6
• Cytogenetics: 14q32.13
• Summary: The protein encoded by this gene belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2010]
• Protein Families: Druggable Genome, Secreted Protein