Nuclear Factor 1 (NFIA) (NM_005595) Human Mass Spec Standard
CAT#: PH304650
NFIA MS Standard C13 and N15-labeled recombinant protein (NP_005586)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204650 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC204650 protein sequence
Red=Cloning site Green=Tags(s) MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPILVPGIKVAASHHPPDR PPDPFSTL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005586 |
RefSeq Size | 9403 |
RefSeq ORF | 1494 |
Synonyms | BRMUTD; CTF; NF-I/A; NF1-A; NFI-A; NFI-L |
Locus ID | 4774 |
UniProt ID | Q12857 |
Cytogenetics | 1p31.3 |
Summary | 'This gene encodes a member of the NF1 (nuclear factor 1) family of transcription factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]' |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417202 | NFIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427477 | NFIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428916 | NFIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417202 | Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 2 |
USD 396.00 |
|
LY427477 | Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 1 |
USD 396.00 |
|
LY428916 | Transient overexpression lysate of nuclear factor I/A (NFIA), transcript variant 3 |
USD 396.00 |
|
PH325878 | NFIA MS Standard C13 and N15-labeled recombinant protein (NP_001128145) |
USD 2,055.00 |
|
TP304650 | Recombinant protein of human nuclear factor I/A (NFIA), transcript variant 2 |
USD 823.00 |
|
TP325878 | Recombinant protein of human nuclear factor I/A (NFIA), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review