Tropomodulin 4 (TMOD4) (NM_013353) Human Mass Spec Standard

CAT#: PH304673

TMOD4 MS Standard C13 and N15-labeled recombinant protein (NP_037485)

Product Images

Coomassie blue staining of purified TMOD4 protein (Cat# TP304673). The protein was produced from HEK293T cells transfected with TMOD4 cDNA clone (Cat# RC204673) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204673
• Predicted MW: 39.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204673 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQ
  YLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTL
  MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPI
  PMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENA
  TLTELRVDNQRQWPGDAVEMEMATVLEQRPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037485
• RefSeq Size: 1322
• RefSeq ORF: 1035
• Synonyms: SK-TMOD
• Locus ID: 29765
• UniProt ID: Q9NZQ9
• Cytogenetics: 1q21.3
• Summary: Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. [UniProtKB/Swiss-Prot Function]