MD2 (LY96) (NM_015364) Human Mass Spec Standard
CAT#: PH304686
LY96 MS Standard C13 and N15-labeled recombinant protein (NP_056179)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204686 |
| Predicted MW | 18.4 kDa |
| Protein Sequence |
>RC204686 protein sequence
Red=Cloning site Green=Tags(s) MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRD LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG SPEEMLFCLEFVILHQPNSN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_056179 |
| RefSeq Size | 642 |
| RefSeq ORF | 480 |
| Synonyms | ESOP-1; ly-96; MD-2; MD2 |
| Locus ID | 23643 |
| UniProt ID | Q9Y6Y9 |
| Cytogenetics | 8q21.11 |
| Summary | This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010] |
| Protein Families | Secreted Protein |
| Protein Pathways | Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414593 | LY96 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY414593 | Transient overexpression lysate of lymphocyte antigen 96 (LY96) |
USD 436.00 |
|
| TP304686 | Recombinant protein of human lymphocyte antigen 96 (LY96) |
USD 823.00 |
|
| TP330968 | Purified recombinant protein of Homo sapiens lymphocyte antigen 96 (LY96), transcript variant 2. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China