CH25H (NM_003956) Human Mass Spec Standard

CAT#: PH304716

CH25H MS Standard C13 and N15-labeled recombinant protein (NP_003947)

Product Images

Coomassie blue staining of purified CH25H protein (Cat# TP304716). The protein was produced from HEK293T cells transfected with CH25H cDNA clone (Cat# RC204716) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204716
• Predicted MW: 31.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204716 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR
  YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF
  VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL
  SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003947
• RefSeq Size: 1378
• RefSeq ORF: 816
• Synonyms: C25H
• Locus ID: 9023
• UniProt ID: O95992
• Cytogenetics: 10q23.31
• Summary: This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Primary bile acid biosynthesis