STK32A (NM_145001) Human Mass Spec Standard
CAT#: PH304769
STK32A MS Standard C13 and N15-labeled recombinant protein (NP_659438)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204769 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC204769 protein sequence
Red=Cloning site Green=Tags(s) MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFK ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQ RIIHRDMKPDNILLDEHDTWLSYKSH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_659438 |
RefSeq Size | 888 |
RefSeq ORF | 498 |
Synonyms | YANK1 |
Locus ID | 202374 |
UniProt ID | Q8WU08 |
Cytogenetics | 5q32 |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408139 | STK32A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426375 | STK32A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408139 | Transient overexpression lysate of serine/threonine kinase 32A (STK32A), transcript variant 2 |
USD 396.00 |
|
LY426375 | Transient overexpression lysate of serine/threonine kinase 32A (STK32A), transcript variant 1 |
USD 396.00 |
|
TP304769 | Recombinant protein of human serine/threonine kinase 32A (STK32A), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review