Thymidylate Synthase (TYMS) (NM_001071) Human Mass Spec Standard

CAT#: PH304814

TYMS MS Standard C13 and N15-labeled recombinant protein (NP_001062)

Product Images

Coomassie blue staining of purified TYMS protein (Cat# TP304814). The protein was produced from HEK293T cells transfected with TYMS cDNA clone (Cat# RC204814) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204814
• Predicted MW: 35.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204814 representing NM_001071
  Red=Cloning site Green=Tags(s)
  
  MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE
  FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR
  HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
  QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR
  ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001062
• RefSeq Size: 1536
• RefSeq ORF: 939
• Synonyms: HST422; TMS; TS
• Locus ID: 7298
• UniProt ID: P04818, Q53Y97
• Cytogenetics: 18p11.32
• Summary: 'Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. [provided by RefSeq, Aug 2017]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, One carbon pool by folate, Pyrimidine metabolism