RRAS (NM_006270) Human Mass Spec Standard

CAT#: PH304820

RRAS MS Standard C13 and N15-labeled recombinant protein (NP_006261)

Product Images

Coomassie blue staining of purified RRAS protein (Cat# TP304820). The protein was produced from HEK293T cells transfected with RRAS cDNA clone (Cat# RC204820) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204820
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204820 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC
  SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV
  GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG
  GGCPCVLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006261
• RefSeq Size: 1013
• RefSeq ORF: 654
• Synonyms: R-Ras
• Locus ID: 6237
• UniProt ID: P10301, A0A024QZF2
• Cytogenetics: 19q13.33
• Summary: 'The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided by RefSeq, Jul 2015]'
• Protein Families: Druggable Genome
• Protein Pathways: MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction