NMNAT1 (NM_022787) Human Mass Spec Standard

CAT#: PH304825

NMNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_073624)

Product Images

Coomassie blue staining of purified NMNAT1 protein (Cat# TP304825). The protein was produced from HEK293T cells transfected with NMNAT1 cDNA clone (Cat# RC204825) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204825
• Predicted MW: 31.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204825 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMA
  ELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKS
  LEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNI
  HVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073624
• RefSeq Size: 3781
• RefSeq ORF: 837
• Synonyms: LCA9; NMNAT; PNAT1
• Locus ID: 64802
• UniProt ID: Q9HAN9, A0A024R4E1
• Cytogenetics: 1p36.22
• Summary: This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15. [provided by RefSeq, Jul 2014]
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism