YARS2 (NM_001040436) Human Mass Spec Standard

CAT#: PH304828

YARS2 MS Standard C13 and N15-labeled recombinant protein (NP_001035526)

Product Images

Coomassie blue staining of purified YARS2 protein (Cat# TP304828). The protein was produced from HEK293T cells transfected with YARS2 cDNA clone (Cat# RC204828) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204828
• Predicted MW: 53.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204828 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPILRSFSWGRWSGTLNLSVLLPLGLRKAHSGAQGLLAAQKARGLFKDFFPETGTKIELPELFDRGTA
  SFPQTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLGDPSGRTKEREALETERVRAN
  ARALRLGLEALAANHQQLFTDGRSWGSFTVLDNSAWYQKQHLVDFLAAVGGHFRMGTLLSRQSVQLRLKS
  PEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTGEDVFGITVPLITSTTGA
  KLGKSAGNAVWLNRDKTSPFELYQFFVRQPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLA
  AEVTKLVHGREGLDSAKRCTQALYHSSIDALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIP
  DGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSLLKIGKRNFYIIKWLQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035526
• RefSeq Size: 2173
• RefSeq ORF: 1431
• Synonyms: CGI-04; MLASA2; MT-TYRRS; TYRRS
• Locus ID: 51067
• UniProt ID: Q9Y2Z4
• Cytogenetics: 12p11.21
• Summary: This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2). [provided by RefSeq, Jan 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis