HINT3 (NM_138571) Human Mass Spec Standard

CAT#: PH304844

HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638)

Product Images

Coomassie blue staining of purified HINT3 protein (Cat# TP304844). The protein was produced from HEK293T cells transfected with HINT3 cDNA clone (Cat# RC204844) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204844
• Predicted MW: 20.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204844 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENED
  LICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCS
  ISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612638
• RefSeq Size: 3396
• RefSeq ORF: 546
• Synonyms: HINT4
• Locus ID: 135114
• UniProt ID: Q9NQE9
• Cytogenetics: 6q22.32
• Summary: Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]). [supplied by OMIM, Mar 2008]