HINT3 (NM_138571) Human Recombinant Protein
CAT#: TP304844
Recombinant protein of human histidine triad nucleotide binding protein 3 (HINT3)
View other "HINT3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204844 protein sequence
Red=Cloning site Green=Tags(s) MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENED LICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCS ISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612638 |
Locus ID | 135114 |
UniProt ID | Q9NQE9 |
Cytogenetics | 6q22.32 |
Refseq Size | 3396 |
Refseq ORF | 546 |
Synonyms | HINT4 |
Summary | Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403361 | HINT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403361 | Transient overexpression lysate of histidine triad nucleotide binding protein 3 (HINT3) |
USD 396.00 |
|
PH304844 | HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review