BACE2 (NM_012105) Human Mass Spec Standard

CAT#: PH304860

BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237)

Product Images

Coomassie blue staining of purified BACE2 protein (Cat# TP304860). The protein was produced from HEK293T cells transfected with BACE2 cDNA clone (Cat# RC204860) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204860
• Predicted MW: 56.18 kDa
• Protein Sequence:
  Sequence Link

  >RC204860 representing NM_012105
  Red=Cloning site Green=Tags(s)
  
  MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS
  PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS
  KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS
  LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK
  LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET
  PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
  RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL
  LLPFRCQRRPRDPEVVNDESSLVRHRWK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036237
• RefSeq Size: 2993
• RefSeq ORF: 1554
• Synonyms: AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
• Locus ID: 25825
• UniProt ID: Q9Y5Z0
• Cytogenetics: 21q22.2-q22.3
• Summary: This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Protease, Transmembrane
• Protein Pathways: Alzheimer's disease