BACE2 (NM_012105) Human Mass Spec Standard
CAT#: PH304860
BACE2 MS Standard C13 and N15-labeled recombinant protein (NP_036237)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204860 |
Predicted MW | 56.18 kDa |
Protein Sequence |
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s) MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL LLPFRCQRRPRDPEVVNDESSLVRHRWK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036237 |
RefSeq Size | 2993 |
RefSeq ORF | 1554 |
Synonyms | AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP |
Locus ID | 25825 |
UniProt ID | Q9Y5Z0 |
Cytogenetics | 21q22.2-q22.3 |
Summary | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408426 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC408427 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415975 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430078 | BACE2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408426 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c |
USD 495.00 |
|
LY408427 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b |
USD 325.00 |
|
LY415975 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a |
USD 325.00 |
|
LY430078 | Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant c |
USD 325.00 |
|
TP304860 | Recombinant protein of human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review