PTP1B (PTPN1) (NM_002827) Human Mass Spec Standard
CAT#: PH304902
PTPN1 MS Standard C13 and N15-labeled recombinant protein (NP_002818)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204902 |
| Predicted MW | 50 kDa |
| Protein Sequence |
>RC204902 protein sequence
Red=Cloning site Green=Tags(s) MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINAS LIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNL KLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGP VVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKF IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT AGAYLCYRFLFNSNT myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002818 |
| RefSeq Size | 3573 |
| RefSeq ORF | 1305 |
| Synonyms | PTP1B |
| Locus ID | 5770 |
| UniProt ID | P18031, A8K3M3 |
| Cytogenetics | 20q13.13 |
| Summary | 'The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]' |
| Protein Families | Druggable Genome, Phosphatase, Transmembrane |
| Protein Pathways | Adherens junction, Insulin signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419087 | PTPN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419087 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 1 (PTPN1) |
USD 436.00 |
|
| TP304902 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 1 (PTPN1) |
USD 823.00 |
|
| TP710202 | Purified recombinant protein of Human protein tyrosine phosphatase, non-receptor type 1 (PTPN1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
| TP750046 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 1 (PTPN1) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China