MIR16 (GDE1) (NM_016641) Human Mass Spec Standard

CAT#: PH304923

GDE1 MS Standard C13 and N15-labeled recombinant protein (NP_057725)

Product Images

Coomassie blue staining of purified GDE1 protein (Cat# TP304923). The protein was produced from HEK293T cells transfected with GDE1 cDNA clone (Cat# RC204923) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204923
• Predicted MW: 37.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204923 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAH
  RGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPA
  ANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNSVVCSFLPEVI
  YKMRQTDRDVITALTHRPWSLSHTGDGKPRYDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDF
  VSPAYLKKWSAKGIQVVGWTVNTFDEKSYYESHLGSSYITDSMVEDCEPHF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057725
• RefSeq Size: 2960
• RefSeq ORF: 993
• Synonyms: 363E6.2; MIR16
• Locus ID: 51573
• UniProt ID: Q9NZC3
• Cytogenetics: 16p12.3
• Protein Families: Transmembrane
• Protein Pathways: Glycerophospholipid metabolism