CBR1 (NM_001757) Human Mass Spec Standard

CAT#: PH304950

CBR1 MS Standard C13 and N15-labeled recombinant protein (NP_001748)

Product Images

Coomassie blue staining of purified CBR1 protein (Cat# TP304950). The protein was produced from HEK293T cells transfected with CBR1 cDNA clone (Cat# RC204950) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204950
• Predicted MW: 30.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204950 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI
  RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS
  IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR
  KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001748
• RefSeq Size: 1321
• RefSeq ORF: 831
• Synonyms: CBR; hCBR1; SDR21C1
• Locus ID: 873
• UniProt ID: P16152, A0A384NL53
• Cytogenetics: 21q22.12
• Summary: 'The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]'
• Protein Families: Druggable Genome
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways