Goat Polyclonal Antibody against CBR1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HGQFVSEKRVEQW, from the C Terminus of the protein sequence according to NP_001748.1. |
Goat Polyclonal Antibody against CBR1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HGQFVSEKRVEQW, from the C Terminus of the protein sequence according to NP_001748.1. |
Carbonyl reductase 1 mouse monoclonal antibody, clone AT2D6, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Carbonyl reductase 1 mouse monoclonal antibody, clone AT2D6, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Rabbit polyclonal anti-CBR1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CBR1. |
Rabbit anti-CBR1 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBR1 |
Mouse Monoclonal CBR1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal CBR1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CBR1 mouse monoclonal antibody, clone AT4E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
CBR1 mouse monoclonal antibody, clone AT4E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-CBR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the middle region of human CBR1. Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ |
Rabbit Polyclonal Anti-CBR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1. Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Carrier-free (BSA/glycerol-free) CBR1 mouse monoclonal antibody, clone OTI4B4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CBR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBR1 |
CBR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBR1 |
CBR1 mouse monoclonal antibody,clone OTI4B4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
CBR1 mouse monoclonal antibody,clone OTI4B4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CBR1 mouse monoclonal antibody,clone OTI4B4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CBR1 mouse monoclonal antibody,clone OTI4B4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |