serum amyloid A2 (SAA2) (NM_030754) Human Mass Spec Standard
CAT#: PH304977
SAA2 MS Standard C13 and N15-labeled recombinant protein (NP_110381)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204977 |
| Predicted MW | 13.5 kDa |
| Protein Sequence |
>RC204977 protein sequence
Red=Cloning site Green=Tags(s) MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGA WAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_110381 |
| RefSeq Size | 594 |
| RefSeq ORF | 366 |
| Synonyms | SAA; SAA1 |
| Locus ID | 6289 |
| UniProt ID | P0DJI9 |
| Cytogenetics | 11p15.1 |
| Summary | 'This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. [provided by RefSeq, Jul 2020]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410691 | SAA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410691 | Transient overexpression lysate of serum amyloid A2 (SAA2), transcript variant 1 |
USD 436.00 |
|
| TP304977 | Recombinant protein of human serum amyloid A2 (SAA2), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China