Cyclin H (CCNH) (NM_001239) Human Mass Spec Standard

CAT#: PH304982

CCNH MS Standard C13 and N15-labeled recombinant protein (NP_001230)

Product Images

Coomassie blue staining of purified CCNH protein (Cat# TP304982). The protein was produced from HEK293T cells transfected with CCNH cDNA clone (Cat# RC204982) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204982
• Predicted MW: 37.6 kDa
• Protein Sequence:
  Sequence Link

  >RC204982 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSV
  FKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKAL
  EQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPS
  QIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC
  HSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001230
• RefSeq Size: 1403
• RefSeq ORF: 969
• Synonyms: CAK; CycH; p34; p37
• Locus ID: 902
• UniProt ID: P51946
• Cytogenetics: 5q14.3
• Summary: 'The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Nov 2010]'
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Nucleotide excision repair