ATP5PO (NM_001697) Human Mass Spec Standard

CAT#: PH304991

ATP5O MS Standard C13 and N15-labeled recombinant protein (NP_001688)

Product Images

Coomassie blue staining of purified ATP5PO protein (Cat# TP304991). The protein was produced from HEK293T cells transfected with ATP5PO cDNA clone (Cat# RC204991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204991
• Predicted MW: 23.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204991 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK
  EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP
  CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR
  EIV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001688
• RefSeq Size: 815
• RefSeq ORF: 639
• Synonyms: ATP5O; ATPO; HMC08D05; OSCP
• Locus ID: 539
• UniProt ID: P48047
• Cytogenetics: 21q22.11
• Summary: 'The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease