SH3BGRL (NM_003022) Human Mass Spec Standard
CAT#: PH304993
SH3BGRL MS Standard C13 and N15-labeled recombinant protein (NP_003013)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204993 |
Predicted MW | 12.8 kDa |
Protein Sequence |
>RC204993 protein sequence
Red=Cloning site Green=Tags(s) MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIF NESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003013 |
RefSeq Size | 2090 |
RefSeq ORF | 342 |
Synonyms | HEL-S-115; SH3BGR |
Locus ID | 6451 |
UniProt ID | O75368, V9HW48 |
Cytogenetics | Xq21.1 |
Summary | '' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418952 | SH3BGRL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418952 | Transient overexpression lysate of SH3 domain binding glutamic acid-rich protein like (SH3BGRL) |
USD 396.00 |
|
TP304993 | Recombinant protein of human SH3 domain binding glutamic acid-rich protein like (SH3BGRL) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review