SH3BGRL (NM_003022) Human Mass Spec Standard

CAT#: PH304993

SH3BGRL MS Standard C13 and N15-labeled recombinant protein (NP_003013)

Product Images

Coomassie blue staining of purified SH3BGRL protein (Cat# TP304993). The protein was produced from HEK293T cells transfected with SH3BGRL cDNA clone (Cat# RC204993) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204993
• Predicted MW: 12.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204993 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIF
  NESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003013
• RefSeq Size: 2090
• RefSeq ORF: 342
• Synonyms: HEL-S-115; SH3BGR
• Locus ID: 6451
• UniProt ID: O75368, V9HW48
• Cytogenetics: Xq21.1
• Summary: ''