PECI (ECI2) (NM_006117) Human Mass Spec Standard

CAT#: PH304994

PECI MS Standard C13 and N15-labeled recombinant protein (NP_006108)

Product Images

Coomassie blue staining of purified ECI2 protein (Cat# TP304994). The protein was produced from HEK293T cells transfected with ECI2 cDNA clone (Cat# RC204994) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204994
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204994 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALG
  SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH
  EIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIA
  VVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGE
  ACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDEC
  TNAVVNFLSRKSKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006108
• RefSeq Size: 1410
• RefSeq ORF: 1092
• Synonyms: ACBD2; dJ1013A10.3; DRS-1; DRS1; HCA88; PECI
• Locus ID: 10455
• UniProt ID: O75521, A0A0C4DGA2
• Cytogenetics: 6p25.2
• Summary: This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
• Protein Pathways: Fatty acid metabolism