Rabbit Polyclonal Anti-PECI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK |
PECI (ECI2) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PECI |
Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ECI2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PECI |
ECI2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PECI |
ECI2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PECI |
ECI2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human ECI2 (NP_006108.2). |
| Modifications | Unmodified |
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
