Antibodies

View as table Download

Rabbit Polyclonal Anti-PECI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK

Rabbit polyclonal anti-PECI antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PECI.

PECI (ECI2) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PECI

Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

ECI2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PECI

ECI2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PECI

ECI2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PECI

ECI2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human ECI2 (NP_006108.2).
Modifications Unmodified

PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

PECI mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PECI mouse monoclonal antibody, clone OTI1C8 (formerly 1C8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

PECI mouse monoclonal antibody, clone OTI1C8 (formerly 1C8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

PECI mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications WB
Reactivities Human
Conjugation Unconjugated