PECI (ECI2) Rabbit Polyclonal Antibody

CAT#: TA346747

Rabbit Polyclonal Anti-PECI Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1
    • 20 ug

USD 823.00


Transient overexpression lysate of peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ECI2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name enoyl-CoA delta isomerase 2
Background This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
Synonyms ACBD2; dJ1013A10.3; DRS-1; DRS1; HCA88; PECI
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Horse: 92%; Guinea pig: 92%; Rabbit: 85%; Zebrafish: 79%
Reference Data
Protein Pathways Fatty acid metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.