PC4 (SUB1) (NM_006713) Human Mass Spec Standard

CAT#: PH304999

SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704)

Product Images

Coomassie blue staining of purified SUB1 protein (Cat# TP304999). The protein was produced from HEK293T cells transfected with SUB1 cDNA clone (Cat# RC204999) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204999
• Predicted MW: 14.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204999 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR
  YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006704
• RefSeq Size: 3522
• RefSeq ORF: 381
• Synonyms: p14; P15; PC4
• Locus ID: 10923
• UniProt ID: P53999, Q6IBA2
• Cytogenetics: 5p13.3
• Summary: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA). [UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors