PIH1D2 (NM_138789) Human Mass Spec Standard

CAT#: PH305039

PIH1D2 MS Standard C13 and N15-labeled recombinant protein (NP_620144)

Product Images

Coomassie blue staining of purified PIH1D2 protein (Cat# TP305039). The protein was produced from HEK293T cells transfected with PIH1D2 cDNA clone (Cat# RC205039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205039
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC205039 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METSSKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPKEKILFINL
  CQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAYNPDVLHAAEKDQVKKNQLIQMAMKCIEEKF
  QFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQV
  SGKAVCLIEEISSTEIQVEMKMPAYELKIVHDHSEKPLKIELKVELPGINSVSLCDLSVSEDDLLIEVSE
  KYRLHLNLPKLIDTEMTTAKFIKEKSTLIITMPLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620144
• RefSeq Size: 1252
• RefSeq ORF: 945
• Synonyms: PIH1 domain containing 2
• Locus ID: 120379
• UniProt ID: Q8WWB5
• Cytogenetics: 11q23.1
• Summary: Belongs to the PIH1 family. [UniProtKB/Swiss-Prot Function]