Stathmin 1 (STMN1) (NM_203401) Human Mass Spec Standard
CAT#: PH305073
STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981946)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205073 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC205073 representing NM_203401
Red=Cloning site Green=Tags(s) MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK DPADETEAD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_981946 |
RefSeq Size | 1730 |
RefSeq ORF | 447 |
Synonyms | C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN |
Locus ID | 3925 |
UniProt ID | P16949 |
Cytogenetics | 1p36.11 |
Summary | 'This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]' |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404338 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404340 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417225 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429256 | STMN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404338 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 2 |
USD 396.00 |
|
LY404340 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 1 |
USD 396.00 |
|
LY417225 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 3 |
USD 396.00 |
|
LY429256 | Transient overexpression lysate of stathmin 1 (STMN1), transcript variant 3 |
USD 396.00 |
|
PH313958 | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_005554) |
USD 2,055.00 |
|
PH320276 | STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981944) |
USD 2,055.00 |
|
TP305073 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 1 |
USD 823.00 |
|
TP313958 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 3 |
USD 748.00 |
|
TP320276 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 2 |
USD 748.00 |
|
TP720152 | Recombinant protein of human stathmin 1/oncoprotein 18 (STMN1), transcript variant 4 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review