Peroxiredoxin 3 (PRDX3) (NM_006793) Human Mass Spec Standard

CAT#: PH305080

PRDX3 MS Standard C13 and N15-labeled recombinant protein (NP_006784)

Product Images

Coomassie blue staining of purified PRDX3 protein (Cat# TP305080). The protein was produced from HEK293T cells transfected with PRDX3 cDNA clone (Cat# RC205080) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205080
• Predicted MW: 27.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205080 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAP
  YFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSH
  LAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVE
  ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006784
• RefSeq Size: 1641
• RefSeq ORF: 768
• Synonyms: AOP-1; AOP1; HBC189; MER5; PRO1748; prx-III; SP-22
• Locus ID: 10935
• UniProt ID: P30048, A0A384MTR2
• Cytogenetics: 10q26.11
• Summary: This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22. [provided by RefSeq, Oct 2014]
• Protein Families: Transcription Factors