Parvin alpha (PARVA) (NM_018222) Human Mass Spec Standard

CAT#: PH305086

PARVA MS Standard C13 and N15-labeled recombinant protein (NP_060692)

Product Images

Coomassie blue staining of purified PARVA protein (Cat# TP305086). The protein was produced from HEK293T cells transfected with PARVA cDNA clone (Cat# RC205086) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205086
• Predicted MW: 42.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205086 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP
  EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
  LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH
  VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN
  LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV
  NCDLKSTLRVLYNLFTKYRNVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060692
• RefSeq Size: 8719
• RefSeq ORF: 1116
• Synonyms: CH-ILKBP; MXRA2
• Locus ID: 55742
• UniProt ID: Q9NVD7
• Cytogenetics: 11p15.3
• Summary: This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010]
• Protein Pathways: Focal adhesion