MVB12B (NM_001011703) Human Mass Spec Standard

CAT#: PH305093

FAM125B MS Standard C13 and N15-labeled recombinant protein (NP_001011703)

Product Images

Coomassie blue staining of purified MVB12B protein (Cat# TP305093). The protein was produced from HEK293T cells transfected with MVB12B cDNA clone (Cat# RC205093) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205093
• Predicted MW: 24.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205093 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVA
  QTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVA
  FRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSS
  AASTPAPNLPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001011703
• RefSeq Size: 2705
• RefSeq ORF: 663
• Synonyms: C9orf28; FAM125B
• Locus ID: 89853
• UniProt ID: Q9H7P6
• Cytogenetics: 9q33.3
• Summary: The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
• Protein Pathways: Endocytosis