C1orf150 (GCSAML) (NM_145278) Human Mass Spec Standard

CAT#: PH305104

C1orf150 MS Standard C13 and N15-labeled recombinant protein (NP_660321)

Product Images

Coomassie blue staining of purified GCSAML protein (Cat# TP305104). The protein was produced from HEK293T cells transfected with GCSAML cDNA clone (Cat# RC205104) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205104
• Predicted MW: 15.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205104 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYT
  VINHIPHQRSSLSSNDDGYENIDSLTRKVRQFRERSETEYALLRTSVSRPCSCTHEHDYEVVFPH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660321
• RefSeq Size: 3863
• RefSeq ORF: 405
• Synonyms: C1orf150
• Locus ID: 148823
• UniProt ID: Q5JQS6, Q6ZVI8
• Cytogenetics: 1q44
• Summary: This gene encodes a protein thought to be a signaling molecule associated with germinal centers, the sites of proliferation and differentiation of mature B lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]