C1orf150 (GCSAML) (NM_145278) Human Recombinant Protein
CAT#: TP305104
Recombinant protein of human chromosome 1 open reading frame 150 (C1orf150)
View other "GCSAML" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205104 protein sequence
Red=Cloning site Green=Tags(s) MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYT VINHIPHQRSSLSSNDDGYENIDSLTRKVRQFRERSETEYALLRTSVSRPCSCTHEHDYEVVFPH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660321 |
Locus ID | 148823 |
UniProt ID | Q5JQS6, Q6ZVI8 |
Cytogenetics | 1q44 |
Refseq Size | 3863 |
Refseq ORF | 405 |
Synonyms | C1orf150 |
Summary | This gene encodes a protein thought to be a signaling molecule associated with germinal centers, the sites of proliferation and differentiation of mature B lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408002 | GCSAML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408002 | Transient overexpression lysate of chromosome 1 open reading frame 150 (C1orf150) |
USD 396.00 |
|
PH305104 | C1orf150 MS Standard C13 and N15-labeled recombinant protein (NP_660321) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review