PDK1 (NM_002610) Human Mass Spec Standard

CAT#: PH305127

PDK1 MS Standard C13 and N15-labeled recombinant protein (NP_002601)

Product Images

Coomassie blue staining of purified PDK1 protein (Cat# TP305127). The protein was produced from HEK293T cells transfected with PDK1 cDNA clone (Cat# RC205127) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205127
• Predicted MW: 49.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205127 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNA
  CEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTD
  TVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSP
  SHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
  FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAV
  PLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
  CVPSREPKDMTTFRSA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002601
• RefSeq Size: 4674
• RefSeq ORF: 1308
• Synonyms: mitochondrial pyruvate dehydrogenase kinase isoenzyme 1; pyruvate dehydrogenase kinase, isoenzyme 1; pyruvate dehydrogenase kinase, isozyme 1
• Locus ID: 5163
• UniProt ID: Q15118
• Cytogenetics: 2q31.1
• Summary: 'Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2013]'
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Fc epsilon RI signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway